Vergleich

Recombinant Human CD30/TNFRSF8 Protein

185,00 €
Zzgl. MwSt.
ArtNr RP00106-100ug
Hersteller Abclonal
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
Sequence FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPC
NCBI TNFRSF8/CD3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD30, D1S166E, Ki-1
Similar products CD30, D1S166E, Ki-1
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Route
C-His
Manufacturers Category
Proteins
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Immunogen
Phe19-Lys379
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint, CAR-T Cell Therapy Targets, Bio-Markers & CD Antigens, TNF family, Biosimilar Drug Targets
Gene Symbol
TNFRSF8/CD30
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Human TNFRSF8/CD30 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe19-Lys379) of human CD30/TNFRSF8 (Accession #NP_001234.2) fused with a 6×His tag at the C-terminus.
Protein Bio Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant Human CD30/TNFRSF8 at 2 μg/mL (100 μL/well) can bind recombinant Human CD30L with a linear range of 1.22-15.23 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
Listenpreis: 185,00 €
Preis: 185,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen