« Zurück
Startseite /
Recombinant Human NRG1-alpha/HRG1-alpha Protein

Recombinant Human NRG1-alpha/HRG1-alpha Protein

59,00 €

Zzgl. MwSt.

ArtNr	RP00055-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Signaling By Cell Type Carcinoma Melanoma Peptides & Proteins Recombinant Proteins Adenocarcinoma Neuronal Cell Markers
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK
NCBI	Pro-neuregulin-1/NRG1（Alpha1）
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF, NRG1-IT2, SMDF
Similar products	HRG, ARIA, GGF, GGF2, HGL, HRG1, HRGA, NDF, SMDF, MST131, MSTP131, NRG1-IT2
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	The protein is a membrane glycoprotein that mediates cell-cell signaling and plays a critical role in the growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are expressed in a tissue-specific manner and differ significantly in their structure, and are classified as types I, II, III, IV, V and VI.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Ser177-Lys241
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor
Gene Symbol	Pro-neuregulin-1/NRG1
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, 5% glycerol, pH 8.0.Contact us for customized product form or formulation.
Protein Description	Active Recombinant Human Pro-neuregulin-1/NRG1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser177-Lys241) of human NRG1-alpha/HRG1-alpha (Accession #NP_039258.1).
Protein Bio Activity	Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is typically 6.2-24.7 ng/mL, corresponding to a specific activity of 4.0×10⁴-1.61×10⁵units/mg.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

Listenpreis: 59,00 €

Preis: 59,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen