Vergleich

OTX2 Rabbit mAb

320,00 €
Zzgl. MwSt.
ArtNr A4351-100ul
Hersteller Abclonal
Menge 100ul
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence AGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
NCBI OTX2
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CPHD6, MCOPS5
Similar products MCOPS5, CPHD6
Lieferbar
Background
This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.
Route
Synthetic Peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 190-289 of human OTX2 (P32243).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
32kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Cell Biology Developmental Biology, Neuroscience, Stem Cells
Gene Symbol
OTX2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100ul
Lieferbar: In stock
Listenpreis: 320,00 €
Preis: 320,00 €
lieferbar

Lieferung vsl. bis 02.12.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen