NARG1 Rabbit pAb

100,00 €

Zzgl. MwSt.

ArtNr	A18504-20ul
Hersteller	Abclonal
Menge	20ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies Western Blot Primary Antibodies By Organ Pancreatic Cancer Nervous System Cancer
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	SWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTA
NCBI	NAA15
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Ga19;NARG1;NAT1P;NATH;TBDN;TBDN100
Similar products	NARG1, NATH, TBDN100, Ga19, NAT1P, TBDN
Lieferbar
Background	N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes the auxillary subunit of the N-terminal acetyltransferase A (NatA) complex.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 150-400 of human NARG1 (NP_476516.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	101kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, RNA Binding, Cardiovascular, Angiogenesis
Gene Symbol	NAA15

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ul

Listenpreis: 100,00 €

Preis: 100,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen